CYP4F11 antibody (N-Term)

Catalog No. ABIN630445

Product Details anti-CYP4F11 Antibody

Target: CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4F11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP4 F11 antibody was raised against the N terminal of CYP4 11

Purification: Purified

Immunogen: CYP4 F11 antibody was raised using the N terminal of CYP4 11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4F11 Blocking Peptide, catalog no. 33R-3022, is also available for use as a blocking control in assays to test for specificity of this CYP4F11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4F11

Target: CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))

Alternative Name: CYP4F11 (CYP4F11 Products)

Synonyms: CYPIVF11 antibody, cytochrome P450, family 4, subfamily F, polypeptide 11 antibody, cytochrome P450 family 4 subfamily F member 11 antibody, CYP4F11 antibody

Background: CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process