SSR2 antibody

Catalog No. ABIN630453

Product Details anti-SSR2 Antibody

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSR2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSR2 Blocking Peptide, catalog no. 33R-8444, is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSR2

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Alternative Name: SSR2 (SSR2 Products)

Synonyms: MUA22.2 antibody, MUA22_2 antibody, DDBDRAFT_0206509 antibody, DDBDRAFT_0266464 antibody, DDB_0206509 antibody, DDB_0266464 antibody, TRAP[b] antibody, TRAPb antibody, wu:fb75b04 antibody, zgc:92180 antibody, 1500032E05Rik antibody, AI315033 antibody, AU020133 antibody, TLAP antibody, TRAPB antibody, TRAPbeta antibody, TRAP-BETA antibody, gp25H antibody, translocon-associated protein beta (TRAPB) family protein antibody, translocon-associated protein subunit beta antibody, Translocon-associated protein subunit beta antibody, signal sequence receptor, beta antibody, signal sequence receptor subunit 2 antibody, signal sequence receptor, beta (translocon-associated protein beta) L homeolog antibody, AT5G14030 antibody, CpipJ_CPIJ005682 antibody, ssr2 antibody, ssrb antibody, Ssr2 antibody, ssr2.L antibody, SSR2 antibody

Background: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).

Molecular Weight: 20 kDa (MW of target protein)