ST6GALNAC5 antibody (Middle Region)

Catalog No. ABIN630476

The Rabbit Polyclonal anti-ST6GALNAC5 antibody has been validated for WB. It is suitable to detect ST6GALNAC5 in samples from Human, Mouse and Rat.

Quick Overview for ST6GALNAC5 antibody (Middle Region) (ABIN630476)

Target: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST6GALNAC5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ST6GALNAC5 Antibody

Binding Specificity: Middle Region

Specificity: ST6 GALNAC5 antibody was raised against the middle region of ST6 ALNAC5

Purification: Purified

Immunogen: ST6 GALNAC5 antibody was raised using the middle region of ST6 ALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST6GALNAC5 Blocking Peptide, (ABIN936553), is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST6GALNAC5

Target: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Alternative Name: ST6GALNAC5

Background: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Molecular Weight: 38 kDa (MW of target protein)