GCNT3 antibody

Catalog No. ABIN630484

Product Details anti-GCNT3 Antibody

Target: GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCNT3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCNT3 Blocking Peptide, catalog no. 33R-1261, is also available for use as a blocking control in assays to test for specificity of this GCNT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCNT3

Target: GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))

Alternative Name: GCNT3 (GCNT3 Products)

Synonyms: C2/4GnT antibody, C24GNT antibody, C2GNT2 antibody, C2GNTM antibody, GNTM antibody, 2010013H22Rik antibody, 2210021I22Rik antibody, 2210401J11Rik antibody, beta-16-N-acetylglucosaminyltransferase antibody, dI/C2/C4GnT antibody, c2/4gnt antibody, c24gnt antibody, c2gnt2 antibody, c2gntm antibody, gntm antibody, glucosaminyl (N-acetyl) transferase 3, mucin type antibody, glucosaminyl (N-acetyl) transferase 3, mucin type L homeolog antibody, GCNT3 antibody, Gcnt3 antibody, gcnt3.L antibody

Background: This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response