SAMSN1 antibody (Middle Region)
-
- Target See all SAMSN1 Antibodies
- SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SAMSN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SAMSN1 antibody was raised against the middle region of SAMSN1
- Purification
- Affinity purified
- Immunogen
- SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
- Top Product
- Discover our top product SAMSN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SAMSN1 Blocking Peptide, catalog no. 33R-2007, is also available for use as a blocking control in assays to test for specificity of this SAMSN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMSN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))
- Alternative Name
- SAMSN1 (SAMSN1 Products)
- Synonyms
- HACS1 antibody, NASH1 antibody, SASH2 antibody, SH3D6B antibody, SLy2 antibody, 4930571B16Rik antibody, 930571B16Rik antibody, Hacs1 antibody, Nash antibody, samsn1 antibody, wu:fa92h05 antibody, wu:fq83f12 antibody, SAMSN1 antibody, zgc:103427 antibody, SAM domain, SH3 domain and nuclear localization signals 1 antibody, SAM domain, SH3 domain and nuclear localization signals, 1 antibody, SAM domain, SH3 domain and nuclear localisation signals 1a antibody, SAM domain, SH3 domain and nuclear localisation signals 1b antibody, SAMSN1 antibody, Samsn1 antibody, samsn1a antibody, samsn1b antibody
- Background
- SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.
- Molecular Weight
- 42 kDa (MW of target protein)
-