FSTL5 antibody (Middle Region)

Catalog No. ABIN630564

Product Details anti-FSTL5 Antibody

Target: FSTL5 (Follistatin-Like 5 (FSTL5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FSTL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FSTL5 antibody was raised against the middle region of FSTL5

Purification: Affinity purified

Immunogen: FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FSTL5 Blocking Peptide, catalog no. 33R-6862, is also available for use as a blocking control in assays to test for specificity of this FSTL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FSTL5

Target: FSTL5 (Follistatin-Like 5 (FSTL5))

Alternative Name: FSTL5 (FSTL5 Products)

Synonyms: Mahya antibody, FSTL5 antibody, drMahya-1 antibody, zgc:136225 antibody, 9130207J01Rik antibody, follistatin-like 5 antibody, follistatin like 5 antibody, follistati like 5 antibody, Fstl5 antibody, FSTL5 antibody, fstl5 antibody

Background: The function of Follistatin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 92 kDa (MW of target protein)