PPP1CA antibody (N-Term)
-
- Target See all PPP1CA Antibodies
- PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1CA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPP1 CA antibody was raised against the N terminal of PPP1 A
- Purification
- Affinity purified
- Immunogen
- PPP1 CA antibody was raised using the N terminal of PPP1 A corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC
- Top Product
- Discover our top product PPP1CA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP1CA Blocking Peptide, catalog no. 33R-6411, is also available for use as a blocking control in assays to test for specificity of this PPP1CA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))
- Alternative Name
- PPP1CA (PPP1CA Products)
- Synonyms
- PP-1A antibody, PP1A antibody, PP1alpha antibody, PPP1A antibody, Ppp1c antibody, dism2 antibody, ppp1a antibody, wu:fc04c08 antibody, wu:fc09b07 antibody, wu:fc30g11 antibody, wu:fe05h08 antibody, zgc:85729 antibody, Ppp1ca antibody, fb18b03 antibody, fd20h04 antibody, wu:fb18b03 antibody, wu:fd20h04 antibody, wu:fl22a03 antibody, zgc:55744 antibody, zgc:76940 antibody, protein phosphatase 1 catalytic subunit alpha antibody, protein phosphatase 1, catalytic subunit, alpha isoform antibody, protein phosphatase 1, catalytic subunit, alpha isozyme L homeolog antibody, protein phosphatase 1, catalytic subunit, alpha isozyme antibody, protein phosphatase 1, catalytic subunit, alpha isozyme a antibody, protein phosphatase 1, catalytic subunit, alpha isozyme b antibody, PPP1CA antibody, Ppp1ca antibody, ppp1ca.L antibody, ppp1ca antibody, ppp1caa antibody, ppp1cab antibody
- Background
- PPP1CA is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- M Phase, Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Lipid Metabolism
-