SULT1C4 antibody (Middle Region)

Catalog No. ABIN630588

Product Details anti-SULT1C4 Antibody

Target: SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1C4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SULT1 C4 antibody was raised against the middle region of SULT1 4

Purification: Affinity purified

Immunogen: SULT1 C4 antibody was raised using the middle region of SULT1 4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1C4 Blocking Peptide, catalog no. 33R-3718, is also available for use as a blocking control in assays to test for specificity of this SULT1C4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1C4

Target: SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))

Alternative Name: SULT1C4 (SULT1C4 Products)

Background: SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.

Molecular Weight: 35 kDa (MW of target protein)