SULT1C4 antibody (Middle Region)
-
- Target See all SULT1C4 Antibodies
- SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT1C4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT1 C4 antibody was raised against the middle region of SULT1 4
- Purification
- Affinity purified
- Immunogen
- SULT1 C4 antibody was raised using the middle region of SULT1 4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK
- Top Product
- Discover our top product SULT1C4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT1C4 Blocking Peptide, catalog no. 33R-3718, is also available for use as a blocking control in assays to test for specificity of this SULT1C4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))
- Alternative Name
- SULT1C4 (SULT1C4 Products)
- Background
- SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.
- Molecular Weight
- 35 kDa (MW of target protein)
-