CBP antibody
-
- Target See all CBP (CREBBP) Antibodies
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CBP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
- Top Product
- Discover our top product CREBBP Primary Antibody
-
anti-CREB Binding Protein (CREBBP) (C-Term) antibody
KO Validated CREBBP Reactivity: Human WB, IF, IP, IHC (p), ICC, ChIP Host: Rabbit Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (C-Term) antibodyCREBBP Reactivity: Human, Mouse, Rat WB, IHC, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (AA 951-1050) antibodyCREBBP Reactivity: Human WB, ELISA, IF, PLA Host: Mouse Monoclonal 2H5 unconjugated
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (HRP)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal HRP
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (FITC)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal FITC
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Biotin)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal Biotin
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (PE)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal PE
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (PerCP)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal PerCP
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 594)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal Atto 594
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 488)CREBBP Reactivity: Human WB, IHC Host: Rabbit Polyclonal Atto 488
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CREBBP Blocking Peptide, catalog no. 33R-9216, is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
- Alternative Name
- CREBBP (CREBBP Products)
- Synonyms
- CBP antibody, KAT3A antibody, RSTS antibody, AW558298 antibody, CBP/p300 antibody, p300/CBP antibody, RTS antibody, cbp antibody, crebbp antibody, kat3a antibody, rsts antibody, hmm291030 antibody, Nejire antibody, CREB binding protein antibody, CREB binding protein L homeolog antibody, histone acetyltransferase p300 antibody, CREBBP antibody, Crebbp antibody, crebbp.L antibody, LOC100123220 antibody
- Background
- CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.
- Molecular Weight
- 261 kDa (MW of target protein)
- Pathways
- TCR Signaling, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-
