H2AFX antibody (N-Term)

Catalog No. ABIN630601

This Rabbit Polyclonal antibody specifically detects H2AFX in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for H2AFX antibody (N-Term) (ABIN630601)

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This H2AFX antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-H2AFX Antibody

Binding Specificity: N-Term

Specificity: H2 AFX antibody was raised against the N terminal of H2 FX

Purification: Affinity purified

Immunogen: H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

H2AFX Blocking Peptide, (ABIN5613915), is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for H2AFX

Target: H2AFX (H2A Histone Family, Member X (H2AFX))

Alternative Name: H2AFX

Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, Positive Regulation of Response to DNA Damage Stimulus