DPPA5 antibody (N-Term)
-
- Target See all DPPA5 Antibodies
- DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPPA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DPPA5 antibody was raised against the N terminal of DPPA5
- Purification
- Affinity purified
- Immunogen
- DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
- Top Product
- Discover our top product DPPA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DPPA5 Blocking Peptide, catalog no. 33R-6080, is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPPA5 (Developmental Pluripotency Associated 5 (DPPA5))
- Alternative Name
- DPPA5 (DPPA5 Products)
- Synonyms
- ESG1 antibody, developmental pluripotency associated 5 antibody, DPPA5 antibody, Dppa5 antibody
- Background
- DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
- Molecular Weight
- 13 kDa (MW of target protein)
-