QTRTD1 antibody (N-Term)
-
- Target See all QTRTD1 Antibodies
- QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This QTRTD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- QTRTD1 antibody was raised against the N terminal of QTRTD1
- Purification
- Affinity purified
- Immunogen
- QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI
- Top Product
- Discover our top product QTRTD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRTD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))
- Alternative Name
- QTRTD1 (QTRTD1 Products)
- Synonyms
- 3110012M05Rik antibody, 4930470H18Rik antibody, AI648807 antibody, queuine tRNA-ribosyltransferase accessory subunit 2 antibody, queuine tRNA-ribosyltransferase accessory subunit 2 L homeolog antibody, QTRT2 antibody, qtrt2 antibody, qtrt2.L antibody, Qtrt2 antibody
- Background
- QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-