GMP Synthase antibody (Middle Region)

Catalog No. ABIN630661

Product Details anti-GMP Synthase Antibody

Target: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMP Synthase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GMPS antibody was raised against the middle region of GMPS

Purification: Affinity purified

Immunogen: GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMPS Blocking Peptide, catalog no. 33R-9455, is also available for use as a blocking control in assays to test for specificity of this GMPS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMP Synthase

Target: GMP Synthase (GMPS) (Guanine Monophosphate Synthetase (GMPS))

Alternative Name: GMPS (GMPS Products)

Synonyms: GMPS antibody, AA591640 antibody, AI047208 antibody, sb:cb632 antibody, wu:fb76b01 antibody, wu:fi05a09 antibody, zgc:66002 antibody, guanine monophosphate synthase antibody, guanine monophosphate synthase L homeolog antibody, guanine monophosphate synthetase antibody, GMPS antibody, gmps.L antibody, gmps antibody, Gmps antibody

Background: In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

Molecular Weight: 77 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process