STRADA antibody (C-Term)

Catalog No. ABIN630667

Product Details anti-STRADA Antibody

Target: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STRADA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYK5 antibody was raised against the C terminal of LYK5

Purification: Affinity purified

Immunogen: LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYK5 Blocking Peptide, catalog no. 33R-1125, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STRADA

Target: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Alternative Name: LYK5 (STRADA Products)

Synonyms: fj99g05 antibody, zgc:56109 antibody, wu:fj99g05 antibody, lyk5 antibody, LYK5 antibody, NY-BR-96 antibody, PMSE antibody, STRAD antibody, Stlk antibody, Lyk5 antibody, 2610019A05Rik antibody, 6030402H20Rik antibody, AI480680 antibody, E130112C09Rik antibody, STE20-related kinase adaptor alpha antibody, ste20-related kinase adaptor alpha antibody, STRADA antibody, strada antibody, Strada antibody

Background: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: AMPK Signaling