IMPDH2 antibody
-
- Target See all IMPDH2 Antibodies
- IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IMPDH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
- Top Product
- Discover our top product IMPDH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))
- Alternative Name
- IMPDH2 (IMPDH2 Products)
- Synonyms
- imp2 antibody, impd2 antibody, impdh-ii antibody, impdh2 antibody, IMPD2 antibody, IMPDH-II antibody, IMPD 2 antibody, IMPDH 2 antibody, cb635 antibody, wu:fb64g02 antibody, wu:fc43f09 antibody, IMPD antibody, inosine monophosphate dehydrogenase 2 antibody, IMP (inosine 5'-monophosphate) dehydrogenase 2 antibody, inosine 5'-phosphate dehydrogenase 2 antibody, IMPDH2 antibody, impdh2.S antibody, impdh2 antibody, Impdh2 antibody
- Background
- IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome
-