RORC antibody (N-Term)
-
- Target See all RORC Antibodies
- RORC (RAR-Related Orphan Receptor C (RORC))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RORC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RORC antibody was raised against the N terminal of RORC
- Purification
- Affinity purified
- Immunogen
- RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
- Top Product
- Discover our top product RORC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RORC Blocking Peptide, catalog no. 33R-2655, is also available for use as a blocking control in assays to test for specificity of this RORC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RORC (RAR-Related Orphan Receptor C (RORC))
- Alternative Name
- RORC (RORC Products)
- Synonyms
- NR1F3 antibody, RORG antibody, RZR-GAMMA antibody, RZRG antibody, TOR antibody, Nr1f3 antibody, RORgamma antibody, Thor antibody, RAR related orphan receptor C antibody, RAR-related orphan receptor C antibody, RAR-related orphan receptor gamma antibody, RORC antibody, Rorc antibody
- Background
- RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known, however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-