CENPP antibody (N-Term)

Catalog No. ABIN630748

Product Details anti-CENPP Antibody

Target: CENPP (Centromere Protein P (CENPP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CENPP antibody was raised against the N terminal of CENPP

Purification: Affinity purified

Immunogen: CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPP Blocking Peptide, catalog no. 33R-9748, is also available for use as a blocking control in assays to test for specificity of this CENPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPP

Target: CENPP (Centromere Protein P (CENPP))

Alternative Name: CENPP (CENPP Products)

Synonyms: CENP-P antibody, 1700022C02Rik antibody, 4921518G09Rik antibody, si:ch211-103f16.3 antibody, wu:fb81h12 antibody, zgc:101125 antibody, centromere protein P antibody, CENPP antibody, Cenpp antibody, cenpp antibody

Background: CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Molecular Weight: 33 kDa (MW of target protein)