ACTR1A antibody

Catalog No. ABIN630759

Product Details anti-ACTR1A Antibody

Target: ACTR1A (Alpha Centractin (ACTR1A))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACTR1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR1A Blocking Peptide, catalog no. 33R-1269, is also available for use as a blocking control in assays to test for specificity of this ACTR1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR1A

Target: ACTR1A (Alpha Centractin (ACTR1A))

Alternative Name: ACTR1A (ACTR1A Products)

Synonyms: ARP1 antibody, CTRN1 antibody, Arp1 antibody, alpha-Arp1 antibody, arp1 antibody, centractin antibody, ctrn1 antibody, ACTR1A antibody, ARP1 actin related protein 1 homolog A antibody, ARP1 actin-related protein 1A, centractin alpha antibody, ARP1 actin-related protein 1 homolog A, centractin alpha antibody, ARP1 actin related protein 1 homolog A L homeolog antibody, alpha-centractin antibody, actin-2 antibody, ACTR1A antibody, Actr1a antibody, actr1a.L antibody, actr1a antibody, PTRG_02540 antibody, PAAG_06972 antibody, MCYG_01044 antibody, VDBG_00685 antibody, MGYG_00946 antibody, DICPUDRAFT_88548 antibody, PGTG_04034 antibody, Tsp_06409 antibody

Background: ACTR1A is a 42.6 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: M Phase