WDR4 antibody (N-Term)

Catalog No. ABIN630796

Product Details anti-WDR4 Antibody

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR4 antibody was raised against the N terminal of WDR4

Purification: Affinity purified

Immunogen: WDR4 antibody was raised using the N terminal of WDR4 corresponding to a region with amino acids FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR4 Blocking Peptide, catalog no. 33R-2940, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR4

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Alternative Name: WDR4 (WDR4 Products)

Synonyms: TRM82 antibody, TRMT82 antibody, AI415180 antibody, AI448349 antibody, D530049K22Rik antibody, WD repeat domain 4 antibody, WD repeat domain 4 S homeolog antibody, WDR4 antibody, Wdr4 antibody, wdr4.S antibody

Background: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.

Molecular Weight: 45 kDa (MW of target protein)