Fibronectin 1 antibody (C-Term)

Catalog No. ABIN630804

Product Details anti-Fibronectin 1 Antibody

Target: Fibronectin 1 (FN1)

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibronectin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Fibronectin 1 antibody was raised against the C terminal of FN1

Purification: Affinity purified

Immunogen: Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibronectin 1 Blocking Peptide, catalog no. 33R-6655, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibronectin 1

Target: Fibronectin 1 (FN1)

Alternative Name: Fibronectin 1 (FN1 Products)

Synonyms: FN1 antibody, FN antibody, cig antibody, fibronectin antibody, finc antibody, lets antibody, msf antibody, Fn antibody, fn2 antibody, fb80d10 antibody, wu:fb80d10 antibody, CIG antibody, ED-B antibody, FINC antibody, FNZ antibody, GFND antibody, GFND2 antibody, LETS antibody, MSF antibody, E330027I09 antibody, Fn-1 antibody, FIBNEC antibody, fn-1 antibody, fibronectin 1 antibody, fibronectin 1a antibody, fibronectin 1 S homeolog antibody, FN1 antibody, fn1 antibody, fn1a antibody, Fn1 antibody, fn1.S antibody

Background: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy