RNF44 antibody (N-Term)

Catalog No. ABIN630824

Product Details anti-RNF44 Antibody

Target: RNF44 (Ring Finger Protein 44 (RNF44))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF44 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF44 antibody was raised against the N terminal of RNF44

Purification: Affinity purified

Immunogen: RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF44 Blocking Peptide, catalog no. 33R-5467, is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF44

Target: RNF44 (Ring Finger Protein 44 (RNF44))

Alternative Name: RNF44 (RNF44 Products)

Synonyms: AI854545 antibody, mKIAA1100 antibody, ring finger protein 44 antibody, RNF44 antibody, Rnf44 antibody

Background: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molecular Weight: 48 kDa (MW of target protein)