NHEDC1 antibody (N-Term)

Catalog No. ABIN630833

Product Details anti-NHEDC1 Antibody

Target: NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHEDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NHEDC1 antibody was raised against the N terminal of NHEDC1

Purification: Affinity purified

Immunogen: NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NHEDC1 Blocking Peptide, catalog no. 33R-6104, is also available for use as a blocking control in assays to test for specificity of this NHEDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHEDC1

Target: NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))

Alternative Name: NHEDC1 (NHEDC1 Products)

Synonyms: NHA1 antibody, NHEDC1 antibody, 1700094G20Rik antibody, 4933424B12Rik antibody, 4933425K02Rik antibody, AV258602 antibody, Nhedc1 antibody, mtsNHE antibody, solute carrier family 9 member B1 antibody, solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 antibody, SLC9B1 antibody, Slc9b1 antibody

Background: NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.

Molecular Weight: 52 kDa (MW of target protein)