TNKS1BP1 antibody (Middle Region)
-
- Target See all TNKS1BP1 Antibodies
- TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNKS1BP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TNKS1 BP1 antibody was raised against the middle region of TNKS1 P1
- Purification
- Affinity purified
- Immunogen
- TNKS1 BP1 antibody was raised using the middle region of TNKS1 P1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE
- Top Product
- Discover our top product TNKS1BP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNKS1BP1 Blocking Peptide, catalog no. 33R-1945, is also available for use as a blocking control in assays to test for specificity of this TNKS1BP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNKS1BP1 (Tankyrase 1 Binding Protein 1, 182kDa (TNKS1BP1))
- Alternative Name
- TNKS1BP1 (TNKS1BP1 Products)
- Synonyms
- TAB182 antibody, Tab182 antibody, mKIAA1741 antibody, tankyrase 1 binding protein 1 antibody, 182 kDa tankyrase-1-binding protein antibody, TNKS1BP1 antibody, LOC100625088 antibody, Tnks1bp1 antibody
- Background
- TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.
- Molecular Weight
- 190 kDa (MW of target protein)
-