MBP antibody (Middle Region)

Catalog No. ABIN630897

Product Details anti-MBP Antibody

Target: MBP (Myelin Basic Protein (MBP))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MBP antibody was raised against the middle region of MBP

Purification: Affinity purified

Immunogen: MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBP Blocking Peptide, catalog no. 33R-2945, is also available for use as a blocking control in assays to test for specificity of this MBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBP

Target: MBP (Myelin Basic Protein (MBP))

Alternative Name: Myelin basic protein (MBP Products)

Synonyms: C76307 antibody, Hmbpr antibody, R75289 antibody, golli-mbp antibody, mld antibody, shi antibody, Mbps antibody, cb274 antibody, fj33b11 antibody, mbp antibody, wu:fj33b11 antibody, wu:fq15b02 antibody, zgc:136630 antibody, MGC115135 antibody, myelin basic protein antibody, myelin basic protein a antibody, myelin basic protein L homeolog antibody, MBP antibody, Mbp antibody, mbpa antibody, mbp antibody, mbp.L antibody

Background: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.

Molecular Weight: 33 kDa (MW of target protein)