HMGCS1 antibody

Catalog No. ABIN630954

Product Details anti-HMGCS1 Antibody

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGCS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMGCS1 Blocking Peptide, catalog no. 33R-4286, is also available for use as a blocking control in assays to test for specificity of this HMGCS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMGCS1

Target: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))

Alternative Name: HMGCS1 (HMGCS1 Products)

Synonyms: HMGCS antibody, zgc:56481 antibody, B130032C06Rik antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 1 antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) antibody, 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 antibody, 3-hydroxy-3-methylglutaryl coenzyme A synthase antibody, hydroxymethylglutaryl-CoA synthase antibody, 3-hydroxy-3-methylglutaryl-CoA synthase antibody, hydroxymethylglutaryl coenzyme A synthase antibody, 3-hydroxy-3-methylglutaryl-CoA synthase 1 S homeolog antibody, HMGCS1 antibody, hmgcs1 antibody, Hmgcs1 antibody, mvaS antibody, SAS2432 antibody, SZO_RS04705 antibody, SEQ_1109 antibody, NAEGRDRAFT_77778 antibody, hmgcs1.S antibody

Background: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha