CCNDBP1 antibody (Middle Region)

Catalog No. ABIN630965

Product Details anti-CCNDBP1 Antibody

Target: CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCNDBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin D-Type Binding-Protein 1 antibody was raised against the middle region of CCNDBP1

Purification: Affinity purified

Immunogen: Cyclin D-Type Binding-Protein 1 antibody was raised using the middle region of CCNDBP1 corresponding to a region with amino acids KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin D-Type Binding-Protein 1 Blocking Peptide, catalog no. 33R-4575, is also available for use as a blocking control in assays to test for specificity of this Cyclin D-Type Binding-Protein 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNDBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCNDBP1

Target: CCNDBP1 (Cyclin D-Type Binding-Protein 1 (CCNDBP1))

Alternative Name: Cyclin D-Type Binding-Protein 1 (CCNDBP1 Products)

Synonyms: CCNDBP1 antibody, dip1 antibody, gcip antibody, DIP1 antibody, GCIP antibody, HHM antibody, AU022347 antibody, Maid antibody, SECC-8 antibody, SSEC-8 antibody, cyclin D1 binding protein 1 antibody, cyclin D-type binding-protein 1 antibody, CCNDBP1 antibody, ccndbp1 antibody, Ccndbp1 antibody

Background: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D.

Molecular Weight: 40 kDa (MW of target protein)