GPX4 antibody

Catalog No. ABIN631020

Product Details anti-GPX4 Antibody

Target: GPX4 (Glutathione Peroxidase 4 (GPX4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPX4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPX4 Blocking Peptide, catalog no. 33R-7765, is also available for use as a blocking control in assays to test for specificity of this GPX4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPX4

Target: GPX4 (Glutathione Peroxidase 4 (GPX4))

Alternative Name: GPX4 (GPX4 Products)

Synonyms: GPx-4 antibody, GSHPx-4 antibody, MCSP antibody, PHGPx antibody, snGPx antibody, snPHGPx antibody, Phgpx antibody, gpx-4 antibody, snGpx antibody, cb563 antibody, cb691 antibody, PHGPxa antibody, sb:cb563 antibody, zgc:92253 antibody, wu:fb82e03 antibody, 1700027O09Rik antibody, mtPHGPx antibody, ATGPX4 antibody, F11L15.5 antibody, glutathione peroxidase 4 antibody, GP-GPx4 antibody, glutathione peroxidase 4 antibody, glutathione peroxidase 4a antibody, GPX4 antibody, Gpx4 antibody, gpx4a antibody

Background: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Molecular Weight: 22 kDa (MW of target protein)