RPS21 antibody (Middle Region)
-
- Target See all RPS21 Antibodies
- RPS21 (Ribosomal Protein S21 (RPS21))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPS21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPS21 antibody was raised against the middle region of RPS21
- Purification
- Affinity purified
- Immunogen
- RPS21 antibody was raised using the middle region of RPS21 corresponding to a region with amino acids NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF
- Top Product
- Discover our top product RPS21 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPS21 Blocking Peptide, catalog no. 33R-6907, is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS21 (Ribosomal Protein S21 (RPS21))
- Alternative Name
- RPS21 (RPS21 Products)
- Synonyms
- CG2986 antibody, Dmel\\CG2986 antibody, M(2)23B antibody, l(2)03575 antibody, l(2)168/14 antibody, l(2)k16814 antibody, oho23 antibody, oho23B antibody, rpS21 antibody, RPS21 antibody, S21 antibody, 1810049N11Rik antibody, 2410030A14Rik antibody, zgc:56642 antibody, zgc:86816 antibody, Ribosomal protein S21 antibody, 40S ribosomal protein S21 antibody, ribosomal protein S21 antibody, ribosomal protein S21 S homeolog antibody, RpS21 antibody, rps21b antibody, rps-21 antibody, RPS21 antibody, Rps21 antibody, rps21 antibody, rps21.S antibody
- Background
- The function of RPS21 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 9 kDa (MW of target protein)
-