PCNP antibody (Middle Region)

Catalog No. ABIN631140

The Rabbit Polyclonal anti-PCNP antibody (ABIN631140) specifically detects PCNP in WB. The antibody is reactive with Human samples.

Quick Overview for PCNP antibody (Middle Region) (ABIN631140)

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCNP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCNP Antibody

Binding Specificity: Middle Region

Specificity: PCNP antibody was raised against the middle region of PCNP

Purification: Affinity purified

Immunogen: PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCNP Blocking Peptide, (ABIN936688), is also available for use as a blocking control in assays to test for specificity of this PCNP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCNP

Target: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Alternative Name: PCNP

Background: PCNP may be involved in cell cycle regulation.

Molecular Weight: 19 kDa (MW of target protein)