NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (N-Term) antibody

Catalog No. ABIN631143

The Rabbit Polyclonal anti-NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor antibody (ABIN631143) specifically detects NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (N-Term) antibody (ABIN631143)

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: NELF antibody was raised against the N terminal of NELF

Purification: Affinity purified

Immunogen: NELF antibody was raised using the N terminal of NELF corresponding to a region with amino acids GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NELF Blocking Peptide, (ABIN938531), is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Alternative Name: NELF

Background: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Synaptic Membrane