DYNLL1 antibody (Middle Region)
-
- Target See all DYNLL1 Antibodies
- DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DYNLL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DYNLL1 antibody was raised against the middle region of DYNLL1
- Purification
- Affinity purified
- Immunogen
- DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
- Top Product
- Discover our top product DYNLL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DYNLL1 Blocking Peptide, catalog no. 33R-2498, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))
- Alternative Name
- DYNLL1 (DYNLL1 Products)
- Synonyms
- DLC1 antibody, DLC8 antibody, DNCL1 antibody, DNCLC1 antibody, LC8 antibody, LC8a antibody, PIN antibody, hdlc1 antibody, dynll2 antibody, wu:fd56c09 antibody, zgc:73406 antibody, Dlc8 antibody, Dnclc1 antibody, Pin antibody, 8kDLC antibody, lc8 antibody, dlc1 antibody, dlc8 antibody, lc8a antibody, dncl1 antibody, dnclc1 antibody, dynll1a antibody, MGC68763 antibody, CDLC2 antibody, dynll1 antibody, dynll1b antibody, pin antibody, MGC89636 antibody, dynein light chain LC8-type 1 antibody, dynein, light chain, LC8-type 1 antibody, dynein light chain LC8-type 1 S homeolog antibody, dynein light chain LC8-type 1 L homeolog antibody, Dynein light chain 1, cytoplasmic antibody, DYNLL1 antibody, dynll1 antibody, Dynll1 antibody, dynll1.S antibody, dynll1.L antibody, dlc-1 antibody
- Background
- Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains.
- Molecular Weight
- 10 kDa (MW of target protein)
- Pathways
- M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity
-