UBASH3A antibody (Middle Region)

Catalog No. ABIN631208

Product Details anti-UBASH3A Antibody

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBASH3A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBASH3 A antibody was raised against the middle region of UBASH3

Purification: Affinity purified

Immunogen: UBASH3 A antibody was raised using the middle region of UBASH3 corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBASH3A Blocking Peptide, catalog no. 33R-7001, is also available for use as a blocking control in assays to test for specificity of this UBASH3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBASH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBASH3A

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Alternative Name: UBASH3A (UBASH3A Products)

Synonyms: UBASH3A antibody, CLIP4 antibody, STS-2 antibody, TULA antibody, TULA-1 antibody, 5830413C03Rik antibody, C330001M22 antibody, Sts-2 antibody, ubiquitin associated and SH3 domain containing A antibody, ubiquitin associated and SH3 domain containing, A antibody, UBASH3A antibody, Ubash3a antibody

Background: UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

Molecular Weight: 74 kDa (MW of target protein)