UBASH3A antibody (Middle Region)

Catalog No. ABIN631208

The Rabbit Polyclonal anti-UBASH3A antibody is suitable to detect UBASH3A in samples from Human. It has been validated for WB.

Quick Overview for UBASH3A antibody (Middle Region) (ABIN631208)

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBASH3A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBASH3A Antibody

Binding Specificity: Middle Region

Specificity: UBASH3 A antibody was raised against the middle region of UBASH3

Purification: Affinity purified

Immunogen: UBASH3 A antibody was raised using the middle region of UBASH3 corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBASH3A Blocking Peptide, (ABIN5616858), is also available for use as a blocking control in assays to test for specificity of this UBASH3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBASH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBASH3A

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Alternative Name: UBASH3A

Background: UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

Molecular Weight: 74 kDa (MW of target protein)