MAP2K7 antibody (Middle Region)

Catalog No. ABIN631268

Product Details anti-MAP2K7 Antibody

Target: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP2K7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP2 K7 antibody was raised against the middle region of MAP2 7

Purification: Affinity purified

Immunogen: MAP2 K7 antibody was raised using the middle region of MAP2 7 corresponding to a region with amino acids ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP2K7 Blocking Peptide, catalog no. 33R-2695, is also available for use as a blocking control in assays to test for specificity of this MAP2K7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP2K7

Target: MAP2K7 (Mitogen-Activated Protein Kinase Kinase 7 (MAP2K7))

Alternative Name: MAP2K7 (MAP2K7 Products)

Synonyms: MAP2K7 antibody, 2 antibody, JNKK antibody, Jnkk2 antibody, Mapkk7 antibody, Mek7 antibody, Mkk7 antibody, MAPKK7 antibody, MKK7 antibody, PRKMK7 antibody, SAPKK-4 antibody, SAPKK4 antibody, 5930412N11Rik antibody, JNKK 2 antibody, MAPKK 7 antibody, MEK 7 antibody, Prkmk7 antibody, sek2 antibody, si:ch211-254d18.2 antibody, map2k7-A antibody, mitogen-activated protein kinase kinase 7 antibody, mitogen activated protein kinase kinase 7 antibody, mitogen-activated protein kinase kinase 7 L homeolog antibody, MAP2K7 antibody, Map2k7 antibody, map2k7 antibody, map2k7.L antibody

Background: MAP2K7 is a stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: MAPK Signaling, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, BCR Signaling