CRABP2 antibody (Middle Region)
-
- Target See all CRABP2 Antibodies
- CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRABP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRABP2 antibody was raised against the middle region of CRABP2
- Purification
- Affinity purified
- Immunogen
- CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI
- Top Product
- Discover our top product CRABP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRABP2 Blocking Peptide, catalog no. 33R-2877, is also available for use as a blocking control in assays to test for specificity of this CRABP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRABP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))
- Alternative Name
- CRABP2 (CRABP2 Products)
- Synonyms
- crabp antibody, crabp2-A antibody, xCRABP antibody, xCRABP-b antibody, cb432 antibody, cb434 antibody, crabp2 antibody, sb:cb434 antibody, wu:fc51a11 antibody, zgc:110496 antibody, CRABP2 antibody, rbp6 antibody, MGC89469 antibody, crabp-ii antibody, CRABP-II antibody, RBP6 antibody, AI893628 antibody, Crabp-2 antibody, CrabpII antibody, im:7136989 antibody, cellular retinoic acid binding protein 2 L homeolog antibody, cellular retinoic acid binding protein 2, a antibody, cellular retinoic acid binding protein 2 antibody, cellular retinoic acid binding protein II antibody, cellular retinoic acid binding protein 2, b antibody, crabp2.L antibody, crabp2a antibody, CRABP2 antibody, crabp2 antibody, Crabp2 antibody, crabp2b antibody
- Background
- A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 geneuggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
- Molecular Weight
- 16 kDa (MW of target protein)
-