EEF1G antibody (Middle Region)
-
- Target See all EEF1G Antibodies
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EEF1G antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EEF1 G antibody was raised against the middle region of EEF1
- Purification
- Affinity purified
- Immunogen
- EEF1 G antibody was raised using the middle region of EEF1 corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE
- Top Product
- Discover our top product EEF1G Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EEF1G Blocking Peptide, catalog no. 33R-7829, is also available for use as a blocking control in assays to test for specificity of this EEF1G antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EEF1G (Eukaryotic Translation Elongation Factor 1 gamma (EEF1G))
- Alternative Name
- EEF1G (EEF1G Products)
- Synonyms
- EF1G antibody, GIG35 antibody, eEF-1 gamma antibody, db03h10 antibody, fk76a09 antibody, mg:db03h10 antibody, wu:fk76a09 antibody, 2610301D06Rik antibody, AA407312 antibody, eef1g antibody, ef1g antibody, gig35 antibody, eukaryotic translation elongation factor 1 gamma antibody, eukaryotic translation elongation factor 1 gamma L homeolog antibody, eukaryotic translation elongation factor 1 gamma S homeolog antibody, EEF1G antibody, eef1g antibody, Eef1g antibody, eef1g.L antibody, eef1g.S antibody, EHI_119540 antibody, CMU_014590 antibody
- Background
- EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
- Molecular Weight
- 50 kDa (MW of target protein)
-