NUDT13 antibody
-
- Target See all NUDT13 Antibodies
- NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDT13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NUDT13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY
- Top Product
- Discover our top product NUDT13 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDT13 Blocking Peptide, catalog no. 33R-6470, is also available for use as a blocking control in assays to test for specificity of this NUDT13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT13 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13))
- Alternative Name
- NUDT13 (NUDT13 Products)
- Synonyms
- si:ch211-146f4.4 antibody, 4933433B15Rik antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 13 antibody, uncharacterized LOC100157023 antibody, nudix hydrolase 13 L homeolog antibody, nudix hydrolase 13 antibody, nudt13 antibody, LOC100157023 antibody, nudt13.L antibody, NUDT13 antibody, Nudt13 antibody
- Background
- NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.
- Molecular Weight
- 40 kDa (MW of target protein)
-