RNF125 antibody (Middle Region)

Catalog No. ABIN631338

Product Details anti-RNF125 Antibody

Target: RNF125 (Ring Finger Protein 125 (RNF125))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF125 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF125 antibody was raised against the middle region of RNF125

Purification: Affinity purified

Immunogen: RNF125 antibody was raised using the middle region of RNF125 corresponding to a region with amino acids ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF125 Blocking Peptide, catalog no. 33R-2614, is also available for use as a blocking control in assays to test for specificity of this RNF125 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF125 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF125

Target: RNF125 (Ring Finger Protein 125 (RNF125))

Alternative Name: RNF125 (RNF125 Products)

Synonyms: 4930553F04Rik antibody, TRAC-1 antibody, TRAC1 antibody, ring finger protein 125 antibody, RNF125 antibody, Rnf125 antibody

Background: This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.

Molecular Weight: 26 kDa (MW of target protein)