TRIM67 antibody (C-Term)

Catalog No. ABIN631345

Product Details anti-TRIM67 Antibody

Target: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM67 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM67 antibody was raised against the C terminal of TRIM67

Purification: Affinity purified

Immunogen: TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM67 Blocking Peptide, catalog no. 33R-3305, is also available for use as a blocking control in assays to test for specificity of this TRIM67 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM67 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM67

Target: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Alternative Name: TRIM67 (TRIM67 Products)

Synonyms: TNL antibody, D130049O21Rik antibody, RGD1560667 antibody, tripartite motif containing 67 antibody, tripartite motif-containing 67 antibody, TRIM67 antibody, Trim67 antibody

Background: The specific function of TRIM67 is not yet known.

Molecular Weight: 84 kDa (MW of target protein)