FAU antibody

Catalog No. ABIN631405

Product Details anti-FAU Antibody

Target: FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAU antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FAU antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAU Blocking Peptide, catalog no. 33R-9774, is also available for use as a blocking control in assays to test for specificity of this FAU antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAU

Target: FAU (Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU))

Alternative Name: FAU (FAU Products)

Synonyms: FAU1 antibody, Fub1 antibody, Fubi antibody, MNSFbeta antibody, RPS30 antibody, S30 antibody, asr1 antibody, Asr1 antibody, MGC73171 antibody, zgc:73171 antibody, FAU, ubiquitin like and ribosomal protein S30 fusion antibody, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) antibody, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed a antibody, FAU antibody, Fau antibody, faua antibody

Background: FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.

Molecular Weight: 14 kDa (MW of target protein)