GSTM2 antibody

Catalog No. ABIN631421

Product Details anti-GSTM2 Antibody

Target: GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTM2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTM2 Blocking Peptide, catalog no. 33R-9250, is also available for use as a blocking control in assays to test for specificity of this GSTM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTM2

Target: GSTM2 (Glutathione S-Transferase mu 2 (Muscle) (GSTM2))

Alternative Name: GSTM2 (GSTM2 Products)

Synonyms: GSTA4 antibody, GST4 antibody, GSTM antibody, GSTM2-2 antibody, GTHMUS antibody, Gstb-2 antibody, Gstb2 antibody, GSTIV antibody, glutathione S-transferase mu 2 antibody, glutathione S-transferase mu 2 (muscle) antibody, glutathione S-transferase Mu 2 antibody, glutathione S-transferase, mu 2 antibody, glutathione S-transferase 2 antibody, Glutathione S-transferase 4 antibody, Gstm2 antibody, GSTM2 antibody, LOC100732167 antibody, gst2 antibody, gst-4 antibody

Background: GSTM2 is a glutathione S-transferase that belongs to the mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity