B3GNT4 antibody (N-Term)

Catalog No. ABIN631426

Product Details anti-B3GNT4 Antibody

Target: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GNT4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: B3 GNT4 antibody was raised against the N terminal of B3 NT4

Purification: Affinity purified

Immunogen: B3 GNT4 antibody was raised using the N terminal of B3 NT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GNT4 Blocking Peptide, catalog no. 33R-6200, is also available for use as a blocking control in assays to test for specificity of this B3GNT4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GNT4

Target: B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))

Alternative Name: B3GNT4 (B3GNT4 Products)

Synonyms: B3GN-T4 antibody, beta3Gn-T4 antibody, 1010001G17Rik antibody, BGnT-4 antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 antibody, B3GNT4 antibody, B3gnt4 antibody

Background: B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.

Molecular Weight: 42 kDa (MW of target protein)