ACD antibody

Catalog No. ABIN631477

Product Details anti-ACD Antibody

Target: ACD (Adrenocortical Dysplasia Homolog (ACD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACD antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACD Blocking Peptide, catalog no. 33R-4573, is also available for use as a blocking control in assays to test for specificity of this ACD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACD

Target: ACD (Adrenocortical Dysplasia Homolog (ACD))

Alternative Name: ACD (ACD Products)

Synonyms: PIP1 antibody, PTOP antibody, TINT1 antibody, TPP1 antibody, ACD antibody, ACD, shelterin complex subunit and telomerase recruitment factor antibody, adrenocortical dysplasia antibody, ACD antibody, Acd antibody

Background: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance