ACD antibody
-
- Target See all ACD Antibodies
- ACD (Adrenocortical Dysplasia Homolog (ACD))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ
- Top Product
- Discover our top product ACD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACD Blocking Peptide, catalog no. 33R-4573, is also available for use as a blocking control in assays to test for specificity of this ACD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACD (Adrenocortical Dysplasia Homolog (ACD))
- Alternative Name
- ACD (ACD Products)
- Synonyms
- PIP1 antibody, PTOP antibody, TINT1 antibody, TPP1 antibody, ACD antibody, ACD, shelterin complex subunit and telomerase recruitment factor antibody, adrenocortical dysplasia antibody, ACD antibody, Acd antibody
- Background
- ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Telomere Maintenance
-