GSTA3 antibody (Middle Region)

Catalog No. ABIN631512

Product Details anti-GSTA3 Antibody

Target: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSTA3 antibody was raised against the middle region of GSTA3

Purification: Affinity purified

Immunogen: GSTA3 antibody was raised using the middle region of GSTA3 corresponding to a region with amino acids SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTA3 Blocking Peptide, catalog no. 33R-8822, is also available for use as a blocking control in assays to test for specificity of this GSTA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTA3

Target: GSTA3 (Glutathione S-Transferase alpha 3 (GSTA3))

Alternative Name: GSTA3 (GSTA3 Products)

Synonyms: GSTA3 antibody, GST antibody, GSTA1 antibody, GSTA3-3 antibody, GTA3 antibody, GSTA2 antibody, Gst2-3 antibody, Yc2 antibody, glutathione S-transferase alpha 3 antibody, glutathione S-transferase A2 antibody, glutathione S-transferase antibody, glutathione S-transferase, alpha 3 antibody, glutathione S-transferase Yc antibody, GSTA3 antibody, LOC474938 antibody, gsta3 antibody, Gsta3 antibody, LOC100328911 antibody

Background: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta.

Molecular Weight: 25 kDa (MW of target protein)