POLQ antibody

Catalog No. ABIN631551

Product Details anti-POLQ Antibody

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLQ antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLQ antibody was raised using a synthetic peptide corresponding to a region with amino acids SATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLQ Blocking Peptide, catalog no. 33R-8319, is also available for use as a blocking control in assays to test for specificity of this POLQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLQ

Target: POLQ (Polymerase (DNA Directed), theta (POLQ))

Alternative Name: POLQ (POLQ Products)

Synonyms: POLH antibody, PRO0327 antibody, A430110D14Rik antibody, DNA polymerase theta antibody, polymerase (DNA directed), theta antibody, POLQ antibody, polq antibody, LOC100179525 antibody, Polq antibody

Background: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.

Molecular Weight: 180 kDa (MW of target protein)