SCP2 antibody (Middle Region)

Catalog No. ABIN631588

Product Details anti-SCP2 Antibody

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCP2 antibody was raised against the middle region of SCP2

Purification: Affinity purified

Immunogen: SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCP2 Blocking Peptide, catalog no. 33R-6715, is also available for use as a blocking control in assays to test for specificity of this SCP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCP2

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Alternative Name: SCP2 (SCP2 Products)

Synonyms: NLTP antibody, NSL-TP antibody, SCP-2 antibody, SCP-CHI antibody, SCP-X antibody, SCPX antibody, AA409774 antibody, AA409893 antibody, C76618 antibody, C79031 antibody, ns-LTP antibody, NSLIPTR antibody, SCPx antibody, MGC77634 antibody, zgc:77634 antibody, SCP2 antibody, MGC108409 antibody, ATSCP2 antibody, MBD2.8 antibody, MBD2_8 antibody, STEROL CARRIER PROTEIN 2 antibody, PLTP antibody, zgc:101621 antibody, sterol carrier protein 2 antibody, sterol carrier protein 2, liver antibody, sterol carrier protein 2a antibody, sterol carrier protein 2 L homeolog antibody, phospholipid transfer protein homolog1 antibody, uncharacterized LOC101116445 antibody, sterol carrier protein 2b antibody, SCP2 antibody, Scp2 antibody, scp2a antibody, scp2.L antibody, scp2 antibody, CC1G_13192 antibody, plt1 antibody, LOC101116445 antibody, scp2b antibody

Background: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process