METTL2B antibody (N-Term)
-
- Target See all METTL2B Antibodies
- METTL2B (Methyltransferase Like 2B (METTL2B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METTL2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- METTL2 B antibody was raised against the N terminal of METTL2
- Purification
- Affinity purified
- Immunogen
- METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
- Top Product
- Discover our top product METTL2B Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
METTL2B Blocking Peptide, catalog no. 33R-4070, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL2B (Methyltransferase Like 2B (METTL2B))
- Alternative Name
- METTL2B (METTL2B Products)
- Synonyms
- METL antibody, METTL2 antibody, METTL2A antibody, PSENIP1 antibody, Mettl2 antibody, methyltransferase like 2B antibody, METTL2B antibody, Mettl2b antibody
- Background
- METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.
- Molecular Weight
- 43 kDa (MW of target protein)
-