PDAP1 antibody (N-Term)
-
- Target See all PDAP1 Antibodies
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDAP1 antibody was raised against the N terminal of PDAP1
- Purification
- Affinity purified
- Immunogen
- PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
- Top Product
- Discover our top product PDAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDAP1 Blocking Peptide, catalog no. 33R-6287, is also available for use as a blocking control in assays to test for specificity of this PDAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
- Alternative Name
- PDAP1 (PDAP1 Products)
- Synonyms
- pdap1 antibody, zgc:56213 antibody, HASPP28 antibody, PAP antibody, PAP1 antibody, Haspp28 antibody, pdgfa associated protein 1b antibody, 28 kDa heat- and acid-stable phosphoprotein antibody, PDGFA associated protein 1 antibody, pdap1b antibody, CpipJ_CPIJ013582 antibody, PDAP1 antibody, Pdap1 antibody
- Background
- PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-