USP22 antibody (N-Term)
-
- Target See all USP22 Antibodies
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This USP22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- USP22 antibody was raised against the N terminal of USP22
- Purification
- Affinity purified
- Immunogen
- USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD
- Top Product
- Discover our top product USP22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
USP22 Blocking Peptide, catalog no. 33R-8029, is also available for use as a blocking control in assays to test for specificity of this USP22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP22 (Ubiquitin Specific Peptidase 22 (USP22))
- Alternative Name
- USP22 (USP22 Products)
- Synonyms
- USP3L antibody, AI427806 antibody, zgc:136342 antibody, usp22 antibody, usp22 b antibody, usp22-B antibody, usp22-a antibody, usp3l antibody, ubiquitin specific peptidase 22 antibody, ubiquitin specific peptidase 22 S homeolog antibody, USP22 antibody, Usp22 antibody, usp22 antibody, usp22.S antibody
- Background
- USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.
- Molecular Weight
- 60 kDa (MW of target protein)
-