RNF6 antibody

Catalog No. ABIN631636

Product Details anti-RNF6 Antibody

Target: RNF6 (RING Finger Protein 6 (RNF6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF6 Blocking Peptide, catalog no. 33R-9514, is also available for use as a blocking control in assays to test for specificity of this RNF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF6

Target: RNF6 (RING Finger Protein 6 (RNF6))

Alternative Name: RNF6 (RNF6 Products)

Synonyms: 1200013I08Rik antibody, 5730419H05Rik antibody, AA537053 antibody, ring finger protein 6 antibody, ring finger protein (C3H2C3 type) 6 antibody, RNF6 antibody, Rnf6 antibody

Background: RNF6 contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Cell Size