VASH1 antibody (Middle Region)
-
- Target See all VASH1 Antibodies
- VASH1 (Vasohibin 1 (VASH1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VASH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Vasohibin 1 antibody was raised against the middle region of VASH1
- Purification
- Affinity purified
- Immunogen
- Vasohibin 1 antibody was raised using the middle region of VASH1 corresponding to a region with amino acids SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA
- Top Product
- Discover our top product VASH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Vasohibin 1 Blocking Peptide, catalog no. 33R-8923, is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VASH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VASH1 (Vasohibin 1 (VASH1))
- Alternative Name
- Vasohibin 1 (VASH1 Products)
- Synonyms
- KIAA1036 antibody, AI834978 antibody, D930046M13Rik antibody, G630009D10Rik antibody, RGD1564082 antibody, vasohibin 1 antibody, VASH1 antibody, vash1 antibody, Vash1 antibody
- Background
- VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.
- Molecular Weight
- 41 kDa (MW of target protein)
-